PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.8KG132000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family M-type_MADS
Protein Properties Length: 60aa    MW: 6652.79 Da    PI: 10.6864
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.8KG132000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF79.22.8e-25350451
                         -SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
               SRF-TF  4 enksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                         e+   rqv fskRr+g+lKKA+ELS LCdaeva+++fs+ g+lyey+s
  Pavir.8KG132000.1.p  3 EDRASRQVRFSKRRAGLLKKAFELSLLCDAEVALLVFSPAGRLYEYAS 50
                         78899*****************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004324.2E-21151IPR002100Transcription factor, MADS-box
PROSITE profilePS5006624.123152IPR002100Transcription factor, MADS-box
SuperFamilySSF554557.46E-22252IPR002100Transcription factor, MADS-box
PfamPF003191.2E-23348IPR002100Transcription factor, MADS-box
PRINTSPR004042.3E-171429IPR002100Transcription factor, MADS-box
PRINTSPR004042.3E-172950IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 60 aa     Download sequence    Send to blast
MAEDRASRQV RFSKRRAGLL KKAFELSLLC DAEVALLVFS PAGRLYEYAS ARFVRPPPP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P8e-174511360Myocyte-specific enhancer factor 2B
1tqe_Q8e-174511360Myocyte-specific enhancer factor 2B
1tqe_R8e-174511360Myocyte-specific enhancer factor 2B
1tqe_S8e-174511360Myocyte-specific enhancer factor 2B
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.5752e-44callus| leaf| root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF1848192e-62KF184819.1 Saccharum hybrid cultivar R570 clone BAC 004J16 complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002457374.12e-24hypothetical protein SORBIDRAFT_03g006210
RefseqXP_004968191.12e-24PREDICTED: truncated transcription factor CAULIFLOWER A-like
SwissprotA2Z9Q75e-20MAD56_ORYSI; MADS-box transcription factor 56
SwissprotP0C5B25e-20MAD56_ORYSJ; MADS-box transcription factor 56
TrEMBLA0A059Q0S24e-25A0A059Q0S2_9POAL; MADS-box transcription factor
TrEMBLM0UMJ04e-25M0UMJ0_HORVD; Uncharacterized protein
STRINGMLOC_12290.11e-24(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP12938398
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45660.14e-21AGAMOUS-like 20